PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g062790.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 175aa    MW: 20255.1 Da    PI: 8.5965
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g062790.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.2e-181771357
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        ++ ++++eq++ Le+ F ++++++ e++ +L+++lg++ rq+++W+qNrRa++k+
  Sopim07g062790.0.1 17 NKKRLNQEQVKLLEASFDSTKKLDLEKKLQLSRELGVPPRQISIWYQNRRARWKN 71
                        56789************************************************95 PP

2HD-ZIP_I/II97.99.8e-3217108293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +k+rl++eqvklLE sF++++kL+ e+K +l+reLg+ prq+ +W+qnrRAR+k++ +E+dy+aL+ ++++  +e+  Leke++ L+ el+
  Sopim07g062790.0.1  17 NKKRLNQEQVKLLEASFDSTKKLDLEKKLQLSRELGVPPRQISIWYQNRRARWKNQSMENDYNALQLKLENALSEKMLLEKETKILQGELE 107
                         79*************************************************************************************9997 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Sopim07g062790.0.1 108 K 108
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.1151272IPR001356Homeobox domain
SuperFamilySSF466892.57E-171381IPR009057Homeodomain-like
SMARTSM003896.3E-171476IPR001356Homeobox domain
CDDcd000865.70E-141573No hitNo description
PfamPF000468.7E-161771IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-191979IPR009057Homeodomain-like
PROSITE patternPS0002704770IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MNSSFNSQNL QKYSKHNKKR LNQEQVKLLE ASFDSTKKLD LEKKLQLSRE LGVPPRQISI  60
WYQNRRARWK NQSMENDYNA LQLKLENALS EKMLLEKETK ILQGELEKAN EMLIGLKSGA  120
QGQIREFTLS TCCEDLISYS TTTRVPNDEV NYSNLQFDEL YAMIGMSNKC CSTW*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009791458.12e-69PREDICTED: homeobox-leucine zipper protein ATHB-52-like
RefseqXP_016444534.12e-69PREDICTED: homeobox-leucine zipper protein ATHB-52-like
TrEMBLK4CGW21e-126K4CGW2_SOLLC; Uncharacterized protein
STRINGSolyc07g062790.1.11e-125(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.13e-30homeobox protein 52